SCOPe 2.08: Domain d1taqa4: 1taq A:423-832

Lineage for d1taqa4 (1taq A:423-832)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein DNA polymerase I (Klenow fragment) [56674] (3 species)

7. Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries)

8. Domain d1taqa4: 1taq A:423-832 [42991]
   Other proteins in same PDB: d1taqa1, d1taqa2, d1taqa3
   complexed with bgl, zn

Details for d1taqa4

PDB Entry: 1taq, 2.4 Å

PDB Description: structure of taq dna polymerase

PDB Compounds: (A:) taq DNA polymerase

SCOPe Domain Sequences for d1taqa4:

Sequence; same for both SEQRES and ATOM records:

>d1taqa4 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlcccdpnlqnipvrtplgqrirrgfiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Timeline for d1taqa4:

• d1taqa4 first appeared (with stable ids) in SCOP 1.55, called d1taq_4
  
• d1taqa4 appears in SCOPe 2.07