Lineage for d2kzma2 (2kzm A:519-928)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2571155Family e.8.1.1: DNA polymerase I [56673] (5 proteins)
  6. 2571156Protein DNA polymerase I (Klenow fragment) [56674] (3 species)
  7. 2571207Species Escherichia coli [TaxId:562] [56675] (14 PDB entries)
  8. 2571217Domain d2kzma2: 2kzm A:519-928 [42983]
    Other proteins in same PDB: d2kzma1
    protein/DNA complex; complexed with mn, zn

Details for d2kzma2

PDB Entry: 2kzm (more details), 2.6 Å

PDB Description: klenow fragment with normal substrate and zinc and manganese
PDB Compounds: (A:) protein (DNA polymerase I)

SCOPe Domain Sequences for d2kzma2:

Sequence, based on SEQRES records: (download)

>d2kzma2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpggapstseevleelaldyplpkvileyrglaklks
tytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiaped
yvivsadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsak
ainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetl
dgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmim
qvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

Sequence, based on observed residues (ATOM records): (download)

>d2kzma2 e.8.1.1 (A:519-928) DNA polymerase I (Klenow fragment) {Escherichia coli [TaxId: 562]}
hkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrlaelekkaheiageef
nlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvileyrglaklkstytd
klplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegrrirqafiapedyviv
sadysqielrimahlsrdkglltafaegkdihrataaevfglpletvtseqrrsakainf
gliygmsafglarqlniprkeaqkymdlyferypgvleymertraqakeqgyvetldgrr
lylpdikssngarraaaeraainapmqgtaadiikramiavdawlqaeqprvrmimqvhd
elvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqah

SCOPe Domain Coordinates for d2kzma2:

Click to download the PDB-style file with coordinates for d2kzma2.
(The format of our PDB-style files is described here.)

Timeline for d2kzma2: