Lineage for d2kzma1 (2kzm A:324-518)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886679Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
    part of Klenow fragment, KF
  7. 2886729Species Escherichia coli [TaxId:562] [53120] (14 PDB entries)
  8. 2886739Domain d2kzma1: 2kzm A:324-518 [33690]
    Other proteins in same PDB: d2kzma2
    protein/DNA complex; complexed with mn, zn

Details for d2kzma1

PDB Entry: 2kzm (more details), 2.6 Å

PDB Description: klenow fragment with normal substrate and zinc and manganese
PDB Compounds: (A:) protein (DNA polymerase I)

SCOPe Domain Sequences for d2kzma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kzma1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]}
misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi
pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
vtlqlhlkmwpdlqk

SCOPe Domain Coordinates for d2kzma1:

Click to download the PDB-style file with coordinates for d2kzma1.
(The format of our PDB-style files is described here.)

Timeline for d2kzma1: