Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) consists of one domain of this fold |
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
Species Escherichia coli [TaxId:562] [53120] (14 PDB entries) |
Domain d2kzma1: 2kzm A:324-518 [33690] Other proteins in same PDB: d2kzma2 protein/DNA complex; complexed with mn, zn |
PDB Entry: 2kzm (more details), 2.6 Å
SCOPe Domain Sequences for d2kzma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kzma1 c.55.3.5 (A:324-518) Exonuclease domain of prokaryotic DNA polymerase {Escherichia coli [TaxId: 562]} misydnyvtildeetlkawiaklekapvfafdtetdsldnisanlvglsfaiepgvaayi pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad vtlqlhlkmwpdlqk
Timeline for d2kzma1: