Lineage for d1imda_ (1imd A:)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) 
Fold e.7: Sugar phosphatases [56654] (1 superfamily) Superfamily e.7.1: Sugar phosphatases [56655] (1 family) 
Family e.7.1.1: Sugar phosphatases [56656] (6 proteins) 
Protein Inositol monophosphatase [56663] (1 species) Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries) 
Domain d1imda_: 1imd A: [42968]
Details for d1imda_
PDB Entry: 1imd (more details), 2.6 Å
PDB Description: structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis
SCOP Domain Sequences for d1imda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1imda_ e.7.1.1 (A:) Inositol monophosphatase {Human (Homo sapiens)}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqvipl
SCOP Domain Coordinates for d1imda_:
Click to download the PDB-style file with coordinates for d1imda_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1imda_:
- d1imda_ first appeared (with stable ids) in SCOP 1.55
- d1imda_ appears in SCOP 1.57
- d1imda_ appears in SCOP 1.61
- d1imda_ appears in the current release, SCOPe 2.08
View in 3D
