Lineage for d1imeb_ (1ime B:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424284Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 424285Superfamily e.7.1: Carbohydrate phosphatase [56655] (2 families) (S)
  5. 424286Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (6 proteins)
  6. 424424Protein Inositol monophosphatase [56663] (1 species)
  7. 424425Species Human (Homo sapiens) [TaxId:9606] [56664] (8 PDB entries)
  8. 424433Domain d1imeb_: 1ime B: [42960]
    complexed with ca

Details for d1imeb_

PDB Entry: 1ime (more details), 2.25 Å

PDB Description: structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis

SCOP Domain Sequences for d1imeb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1imeb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens)}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdded

SCOP Domain Coordinates for d1imeb_:

Click to download the PDB-style file with coordinates for d1imeb_.
(The format of our PDB-style files is described here.)

Timeline for d1imeb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1imea_