Lineage for d2hhmb_ (2hhm B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015828Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 3015829Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 3015830Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 3016047Protein Inositol monophosphatase [56663] (1 species)
  7. 3016048Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries)
  8. 3016056Domain d2hhmb_: 2hhm B: [42956]
    complexed with gd, so4

Details for d2hhmb_

PDB Entry: 2hhm (more details), 2.1 Å

PDB Description: structure of inositol monophosphatase, the putative target of lithium therapy
PDB Compounds: (B:) inositol monophosphatase

SCOPe Domain Sequences for d2hhmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhmb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
lmsrrviaannrilaeriakeiqviplqrdde

SCOPe Domain Coordinates for d2hhmb_:

Click to download the PDB-style file with coordinates for d2hhmb_.
(The format of our PDB-style files is described here.)

Timeline for d2hhmb_: