Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily) N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet |
Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) |
Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins) |
Protein Inositol monophosphatase [56663] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries) |
Domain d2hhmb_: 2hhm B: [42956] complexed with gd, so4 |
PDB Entry: 2hhm (more details), 2.1 Å
SCOPe Domain Sequences for d2hhmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhmb_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]} wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd lmsrrviaannrilaeriakeiqviplqrdde
Timeline for d2hhmb_: