PDB entry 2hhm

View 2hhm on RCSB PDB site
Description: structure of inositol monophosphatase, the putative target of lithium therapy
Class: hydrolase
Keywords: hydrolase
Deposited on 1992-10-20, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inositol monophosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hhma_
  • Chain 'B':
    Compound: inositol monophosphatase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hhmb_
  • Heterogens: SO4, GD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hhmA (A:)
    adpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikek
    ypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgv
    vyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmek
    lfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtgg
    pfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hhmA (A:)
    wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
    hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
    cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
    ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
    lmsrrviaannrilaeriakeiqviplqrdde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hhmB (B:)
    adpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikek
    ypshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgv
    vyscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmek
    lfcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtgg
    pfdlmsrrviaannrilaeriakeiqviplqrdded
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hhmB (B:)
    wqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikekyps
    hsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvvys
    cvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmeklfc
    ipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggpfd
    lmsrrviaannrilaeriakeiqviplqrdde