Lineage for d1rdxb_ (1rdx B:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266544Fold e.7: Sugar phosphatases [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 266545Superfamily e.7.1: Sugar phosphatases [56655] (1 family) (S)
  5. 266546Family e.7.1.1: Sugar phosphatases [56656] (6 proteins)
  6. 266574Protein Fructose-1,6-bisphosphatase [56657] (5 species)
  7. 266593Species Pig (Sus scrofa) [TaxId:9823] [56658] (33 PDB entries)
  8. 266658Domain d1rdxb_: 1rdx B: [42933]
    complexed with f6p; mutant

Details for d1rdxb_

PDB Entry: 1rdx (more details), 2.75 Å

PDB Description: r-state structure of the arg 243 to ala mutant of pig kidney fructose 1,6-bisphosphatase expressed in e. coli

SCOP Domain Sequences for d1rdxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdxb_ e.7.1.1 (B:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa)}
tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
gaayvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
avldivptdihqrapiilgspedvtelleiyqkhaak

SCOP Domain Coordinates for d1rdxb_:

Click to download the PDB-style file with coordinates for d1rdxb_.
(The format of our PDB-style files is described here.)

Timeline for d1rdxb_: