Lineage for d1rdxa_ (1rdx A:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1691917Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 1691918Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 1691919Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 1691952Protein Fructose-1,6-bisphosphatase [56657] (7 species)
  7. 1691981Species Pig (Sus scrofa) [TaxId:9823] [56658] (65 PDB entries)
  8. 1692088Domain d1rdxa_: 1rdx A: [42932]
    complexed with f6p; mutant

Details for d1rdxa_

PDB Entry: 1rdx (more details), 2.75 Å

PDB Description: r-state structure of the arg 243 to ala mutant of pig kidney fructose 1,6-bisphosphatase expressed in e. coli
PDB Compounds: (A:) fructose 1,6-bisphosphatase

SCOPe Domain Sequences for d1rdxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdxa_ e.7.1.1 (A:) Fructose-1,6-bisphosphatase {Pig (Sus scrofa) [TaxId: 9823]}
tdqaafdtnivtltrfvmeqgrkargtgemtqllnslctavkaistavrkagiahlygia
gstnvtgdqvkkldvlsndlvinvlkssfatcvlvteedknaiivepekrgkyvvcfdpl
dgssnidclvsigtifgiyrknstdepsekdalqpgrnlvaagyalygsatmlvlamvng
vncfmldpaigefilvdrnvkikkkgsiysinegyakefdpaiteyiqrkkfppdnsapy
gaayvgsmvadvhrtlvyggifmypankkspkgklrllyecnpmayvmekagglattgke
avldivptdihqrapiilgspedvtelleiyqkhaak

SCOPe Domain Coordinates for d1rdxa_:

Click to download the PDB-style file with coordinates for d1rdxa_.
(The format of our PDB-style files is described here.)

Timeline for d1rdxa_: