Lineage for d1egcc2 (1egc C:10-241)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140748Fold e.6: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56644] (1 superfamily)
  4. 140749Superfamily e.6.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56645] (1 family) (S)
  5. 140750Family e.6.1.1: Acyl-CoA dehydrogenase (flavoprotein), N-terminal and middle domains [56646] (3 proteins)
  6. 140764Protein Medium chain acyl-CoA dehydrogenase [56649] (2 species)
  7. 140765Species Human (Homo sapiens) [TaxId:9606] [56651] (3 PDB entries)
  8. 140772Domain d1egcc2: 1egc C:10-241 [42863]
    Other proteins in same PDB: d1egca1, d1egcb1, d1egcc1, d1egcd1

Details for d1egcc2

PDB Entry: 1egc (more details), 2.6 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase complexed with octanoyl-coa

SCOP Domain Sequences for d1egcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egcc2 e.6.1.1 (C:10-241) Medium chain acyl-CoA dehydrogenase {Human (Homo sapiens)}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOP Domain Coordinates for d1egcc2:

Click to download the PDB-style file with coordinates for d1egcc2.
(The format of our PDB-style files is described here.)

Timeline for d1egcc2: