SCOP 1.67: Domain d1egdd2: 1egd D:10-241

Lineage for d1egdd2 (1egd D:10-241)

Root: SCOP 1.67
Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families)
flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (5 proteins)
Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [56651] (3 PDB entries)
Domain d1egdd2: 1egd D:10-241 [42860]
Other proteins in same PDB: d1egda1, d1egdb1, d1egdc1, d1egdd1
complexed with fad; mutant

Details for d1egdd2

PDB Entry: 1egd (more details), 2.4 Å

PDB Description: structure of t255e, e376g mutant of human medium chain acyl-coa dehydrogenase

SCOP Domain Sequences for d1egdd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1egdd2 e.6.1.1 (D:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens)}
lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen
cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl
mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap
ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd

SCOP Domain Coordinates for d1egdd2:

Click to download the PDB-style file with coordinates for d1egdd2.
(The format of our PDB-style files is described here.)

Timeline for d1egdd2: