Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (2 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.1: Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains [56646] (5 proteins) |
Protein Medium chain acyl-CoA dehydrogenase, NM domains [56649] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [56651] (3 PDB entries) |
Domain d1egdd2: 1egd D:10-241 [42860] Other proteins in same PDB: d1egda1, d1egdb1, d1egdc1, d1egdd1 complexed with fad; mutant |
PDB Entry: 1egd (more details), 2.4 Å
SCOP Domain Sequences for d1egdd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egdd2 e.6.1.1 (D:10-241) Medium chain acyl-CoA dehydrogenase, NM domains {Human (Homo sapiens)} lgfsfefteqqkefqatarkfareeiipvaaeydktgeypvplirrawelglmnthipen cgglglgtfdacliseelaygctgvqtaiegnslgqmpiiiagndqqkkkylgrmteepl mcaycvtepgagsdvagiktkaekkgdeyiingqkmwitnggkanwyfllarsdpdpkap ankaftgfiveadtpgiqigrkelnmgqrcsdtrgivfedvkvpkenvligd
Timeline for d1egdd2: