Lineage for d1e4dd_ (1e4d D:)

  1. Root: SCOP 1.61
  2. 199953Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 200057Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 200058Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 200059Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)
  6. 200203Protein Class D beta-lactamase [56622] (2 species)
  7. 200204Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (10 PDB entries)
  8. 200226Domain d1e4dd_: 1e4d D: [42762]

Details for d1e4dd_

PDB Entry: 1e4d (more details), 1.8 Å

PDB Description: structure of oxa10 beta-lactamase at ph 8.3

SCOP Domain Sequences for d1e4dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4dd_ e.3.1.1 (D:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
egiigg

SCOP Domain Coordinates for d1e4dd_:

Click to download the PDB-style file with coordinates for d1e4dd_.
(The format of our PDB-style files is described here.)

Timeline for d1e4dd_: