Lineage for d1e4dc_ (1e4d C:)

  1. Root: SCOP 1.63
  2. 266016Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds)
  3. 266132Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 266133Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 266134Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (9 proteins)
  6. 266290Protein Class D beta-lactamase [56622] (3 species)
  7. 266294Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (10 PDB entries)
  8. 266315Domain d1e4dc_: 1e4d C: [42761]

Details for d1e4dc_

PDB Entry: 1e4d (more details), 1.8 Å

PDB Description: structure of oxa10 beta-lactamase at ph 8.3

SCOP Domain Sequences for d1e4dc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e4dc_ e.3.1.1 (C:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfkipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
egiigg

SCOP Domain Coordinates for d1e4dc_:

Click to download the PDB-style file with coordinates for d1e4dc_.
(The format of our PDB-style files is described here.)

Timeline for d1e4dc_: