Lineage for d1c3bb_ (1c3b B:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140467Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 140468Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 140469Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)
  6. 140470Protein AMPC beta-Lactamase, class C [56618] (3 species)
  7. 140483Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (12 PDB entries)
  8. 140493Domain d1c3bb_: 1c3b B: [42744]

Details for d1c3bb_

PDB Entry: 1c3b (more details), 2.25 Å

PDB Description: ampc beta-lactamase from e. coli complexed with inhibitor, benzo(b)thiophene-2-boronic acid (bzb)

SCOP Domain Sequences for d1c3bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3bb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOP Domain Coordinates for d1c3bb_:

Click to download the PDB-style file with coordinates for d1c3bb_.
(The format of our PDB-style files is described here.)

Timeline for d1c3bb_: