Lineage for d1blsb_ (1bls B:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244171Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 2244200Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (10 PDB entries)
    Uniprot P05364 22-380 ! Uniprot P05364 22-381
  8. 2244210Domain d1blsb_: 1bls B: [42742]
    complexed with ipp

Details for d1blsb_

PDB Entry: 1bls (more details), 2.3 Å

PDB Description: crystallographic structure of a phosphonate derivative of the enterobacter cloacae p99 cephalosporinase: mechanistic interpretation of a beta-lactamase transition state analog
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d1blsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1blsb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

SCOPe Domain Coordinates for d1blsb_:

Click to download the PDB-style file with coordinates for d1blsb_.
(The format of our PDB-style files is described here.)

Timeline for d1blsb_: