Lineage for d1blsa_ (1bls A:)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein AMPC beta-Lactamase, class C [56618] (3 species) 
Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (4 PDB entries) 
Domain d1blsa_: 1bls A: [42741]
Details for d1blsa_
PDB Entry: 1bls (more details), 2.3 Å
PDB Description: crystallographic structure of a phosphonate derivative of the enterobacter cloacae p99 cephalosporinase: mechanistic interpretation of a beta-lactamase transition state analog
SCOP Domain Sequences for d1blsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1blsa_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal
SCOP Domain Coordinates for d1blsa_:
Click to download the PDB-style file with coordinates for d1blsa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1blsa_:
- d1blsa_ first appeared (with stable ids) in SCOP 1.55
- d1blsa_ appears in SCOP 1.59
- d1blsa_ appears in SCOP 1.63
- d1blsa_ appears in the current release, SCOPe 2.08
View in 3D
