Lineage for d2bltb_ (2blt B:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 423760Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 423761Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) (S)
  5. 423762Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (10 proteins)
  6. 423763Protein AMPC beta-Lactamase, class C [56618] (3 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. 423770Species Enterobacter cloacae, P99, cephalosporinase [TaxId:550] [56620] (7 PDB entries)
  8. 423776Domain d2bltb_: 2blt B: [42740]

Details for d2bltb_

PDB Entry: 2blt (more details), 2 Å

PDB Description: evolution of an enzyme activity: structure at 2 angstroms resolution of cephalosporinase from the ampc gene of enterobacter cloacae p99 and comparison with a class a penicillinase

SCOP Domain Sequences for d2bltb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bltb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase}
pvsekqlaevvantitplmkaqsvpgmavaviyqgkphyytfgkadiaankpvtpqtlfe
lgsisktftgvlggdaiargeislddavtrywpqltgkqwqgirmldlatytagglplqv
pdevtdnasllrfyqnwqpqwkpgttrlyanasiglfgalavkpsgmpyeqamttrvlkp
lkldhtwinvpkaeeahyawgyrdgkavrvspgmldaqaygvktnvqdmanwvmanmape
nvadaslkqgialaqsrywrigsmyqglgwemlnwpveantvvegsdskvalaplpvaev
nppappvkaswvhktgstggfgsyvafipekqigivmlantsypnparveaayhileal

SCOP Domain Coordinates for d2bltb_:

Click to download the PDB-style file with coordinates for d2bltb_.
(The format of our PDB-style files is described here.)

Timeline for d2bltb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2blta_