Lineage for d1e25a_ (1e25 A:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140467Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 140468Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 140469Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)
  6. 140508Protein beta-Lactamase, class A [56606] (12 species)
  7. 140548Species Pseudomonas aeruginosa, PER-1 [TaxId:287] [56616] (1 PDB entry)
  8. 140549Domain d1e25a_: 1e25 A: [42731]

Details for d1e25a_

PDB Entry: 1e25 (more details), 1.9 Å

PDB Description: the high resolution structure of per-1 class a beta-lactamase

SCOP Domain Sequences for d1e25a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e25a_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PER-1}
spllkeqiesivigkkatvgvavwgpddlepllinpfekfpmqsvfklhlamlvlhqvdq
gkldlnqtvivnrakvlqntwapimkayqgdefsvpvqqllqysvshsdnvacdllfelv
ggpaalhdyiqsmgiketavvaneaqmhaddqvqyqnwtsmkgaaeilkkfeqktqlset
sqallwkwmvetttgperlkgllpagtvvahktgtsqikagktaatndlgiillpdgrpl
lvavfvkdsaessrtneaiiaqvaqtayqfelkklsal

SCOP Domain Coordinates for d1e25a_:

Click to download the PDB-style file with coordinates for d1e25a_.
(The format of our PDB-style files is described here.)

Timeline for d1e25a_: