Lineage for d1e25a_ (1e25 A:)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein beta-Lactamase, class A [56606] (12 species) 
Species Pseudomonas aeruginosa, PER-1 [TaxId:287] [56616] (1 PDB entry) 
Domain d1e25a_: 1e25 A: [42731]
Details for d1e25a_
PDB Entry: 1e25 (more details), 1.9 Å
PDB Description: the high resolution structure of per-1 class a beta-lactamase
SCOP Domain Sequences for d1e25a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e25a_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PER-1}
spllkeqiesivigkkatvgvavwgpddlepllinpfekfpmqsvfklhlamlvlhqvdq
gkldlnqtvivnrakvlqntwapimkayqgdefsvpvqqllqysvshsdnvacdllfelv
ggpaalhdyiqsmgiketavvaneaqmhaddqvqyqnwtsmkgaaeilkkfeqktqlset
sqallwkwmvetttgperlkgllpagtvvahktgtsqikagktaatndlgiillpdgrpl
lvavfvkdsaessrtneaiiaqvaqtayqfelkklsal
SCOP Domain Coordinates for d1e25a_:
Click to download the PDB-style file with coordinates for d1e25a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e25a_:
- d1e25a_ first appeared (with stable ids) in SCOP 1.55
- d1e25a_ appears in SCOP 1.57
- d1e25a_ appears in SCOP 1.61
- d1e25a_ appears in the current release, SCOPe 2.08
View in 3D