Lineage for d1pioa_ (1pio A:)
- Root: SCOP 1.59
Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) 
Protein beta-Lactamase, class A [56606] (12 species) 
Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries) 
Domain d1pioa_: 1pio A: [42719]
Details for d1pioa_
PDB Entry: 1pio (more details), 2.8 Å
PDB Description: an engineered staphylococcus aureus pc1 beta-lactamase that hydrolyses third generation cephalosporins
SCOP Domain Sequences for d1pioa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pioa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqstyasrndvafvypkgqsepivlviftnkdnksdkp
ndklisetaksvmkef
SCOP Domain Coordinates for d1pioa_:
Click to download the PDB-style file with coordinates for d1pioa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pioa_:
- d1pioa_ first appeared (with stable ids) in SCOP 1.55
- d1pioa_ appears in SCOP 1.57
- d1pioa_ appears in SCOP 1.61
- d1pioa_ appears in the current release, SCOPe 2.08
View in 3D
