Lineage for d3blm__ (3blm -)
- Root: SCOP 1.61
Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily) Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins) Protein beta-Lactamase, class A [56606] (13 species) 
Species Staphylococcus aureus [TaxId:1280] [56611] (16 PDB entries) 
Domain d3blm__: 3blm - [42709]
Details for d3blm__
PDB Entry: 3blm (more details), 2 Å
PDB Description: refined crystal structure of beta-lactamase from staphylococcus aureus pc1 at 2.0
SCOP Domain Sequences for d3blm__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3blm__ e.3.1.1 (-) beta-Lactamase, class A {Staphylococcus aureus}
kelndlekkynahigvyaldtksgkevkfnsdkrfayastskainsailleqvpynklnk
kvhinkddivayspilekyvgkditlkalieasmtysdntannkiikeiggikkvkqrlk
elgdkvtnpvryeielnyyspkskkdtstpaafgktlnkliangklskenkkflldlmln
nksgdtlikdgvpkdykvadksgqaityasrndvafvypkgqsepivlviftnkdnksdk
pndklisetaksvmkef
SCOP Domain Coordinates for d3blm__:
Click to download the PDB-style file with coordinates for d3blm__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3blm__:
- d3blm__ first appeared (with stable ids) in SCOP 1.55
- d3blm__ appears in SCOP 1.59
- d3blm__ appears in SCOP 1.63
- d3blm__ appears in the current release, SCOPe 2.08, called d3blma_
View in 3D