Lineage for d1ck3a_ (1ck3 A:)

  1. Root: SCOP 1.59
  2. 140364Class e: Multi-domain proteins (alpha and beta) [56572] (34 folds)
  3. 140467Fold e.3: beta-Lactamase/D-ala carboxypeptidase [56600] (1 superfamily)
  4. 140468Superfamily e.3.1: beta-Lactamase/D-ala carboxypeptidase [56601] (1 family) (S)
  5. 140469Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (8 proteins)
  6. 140508Protein beta-Lactamase, class A [56606] (12 species)
  7. 140519Species Escherichia coli, TEM-1 [TaxId:562] [56607] (13 PDB entries)
  8. 140530Domain d1ck3a_: 1ck3 A: [42698]

Details for d1ck3a_

PDB Entry: 1ck3 (more details), 2.28 Å

PDB Description: n276d mutant of escherichia coli tem-1 beta-lactamase

SCOP Domain Sequences for d1ck3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ck3a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrid
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpvamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmderdrqiaeigaslikhw

SCOP Domain Coordinates for d1ck3a_:

Click to download the PDB-style file with coordinates for d1ck3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ck3a_: