Lineage for d1es3a_ (1es3 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2244157Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2244798Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species)
  7. 2244799Species Streptomyces sp., K15 [TaxId:1931] [56604] (7 PDB entries)
  8. 2244806Domain d1es3a_: 1es3 A: [42685]
    complexed with na; mutant

Details for d1es3a_

PDB Entry: 1es3 (more details), 2.2 Å

PDB Description: c98a mutant of streptomyces k15 dd-transpeptidase
PDB Compounds: (A:) dd-transpeptidase

SCOPe Domain Sequences for d1es3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es3a_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15 [TaxId: 1931]}
kptiaavggyamnngtgttlytkaadtrrstgsttkimtakvvlaqsnlnldakvtiqka
ysdyvvannasqahlivgdkvtvrqllyglmlpsgadaayaladkygsgstraarvksfi
gkmntaatnlglhnthfdsfdgignganystprdltkiassamknstfrtvvktkaytak
tvtktgsirtmdtwkntngllssysgaigvktgsgpeakyclvfaatrggktvigtvlas
tsiparesdatkimnygfal

SCOPe Domain Coordinates for d1es3a_:

Click to download the PDB-style file with coordinates for d1es3a_.
(The format of our PDB-style files is described here.)

Timeline for d1es3a_: