Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.1: Serpins [56573] (1 superfamily) contains a cluster of helices and a beta-sandwich |
Superfamily e.1.1: Serpins [56574] (2 families) |
Family e.1.1.1: Serpins [56575] (17 proteins) automatically mapped to Pfam PF00079 |
Protein Viral serpin crmA (cytokine response modifier protein) [56593] (1 species) |
Species Cowpox virus [TaxId:10243] [56594] (3 PDB entries) |
Domain d1c8o.1: 1c8o A:,B: [42677] cleaved form |
PDB Entry: 1c8o (more details), 2.9 Å
SCOPe Domain Sequences for d1c8o.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1c8o.1 e.1.1.1 (A:,B:) Viral serpin crmA (cytokine response modifier protein) {Cowpox virus [TaxId: 10243]} mdifreiassmkgenvfisppsissvltilyygangstaeqlskyvekeadknkddisfk smnkvygrysavfkdsflrkigdnfqtvdftdsrtvdainksvdiftegkinplldepls pdtsllaisavyfkakwlmpfekeftsdypfyvsptemvdvsmmsmygeafnhasvkesf gnfsiielpyvgdtsmvvilpdnidglesieqnltdtnfkkwsdsmdamfidvhipkfkv tgsynlvdalvklgltevfgstgdysnmsnsdvsvdamihktyidvneeyteaaaatsal Xnefsadhpfiyvirhvdgkilfvgrysspttn
Timeline for d1c8o.1: