Lineage for d1db2b_ (1db2 B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.1: Serpins [56573] (1 superfamily)
    contains a cluster of helices and a beta-sandwich
  4. Superfamily e.1.1: Serpins [56574] (2 families) (S)
  5. Family e.1.1.1: Serpins [56575] (17 proteins)
    automatically mapped to Pfam PF00079
  6. Protein Plasminogen activator inhibitor-1 [56587] (3 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [56588] (21 PDB entries)
  8. Domain d1db2b_: 1db2 B: [42673]

Details for d1db2b_

PDB Entry: 1db2 (more details), 2.7 Å

PDB Description: crystal structure of native plasminogen activator inhibitor-1
PDB Compounds: (B:) plasminogen activator inhibitor-1

SCOPe Domain Sequences for d1db2b_:

Sequence, based on SEQRES records: (download)

>d1db2b_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
hppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaam
gfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvk
qvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpds
sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpf
qadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvv
rhnptgtvlfmgqvmep

Sequence, based on observed residues (ATOM records): (download)

>d1db2b_ e.1.1.1 (B:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]}
hppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaam
gfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvk
qvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpds
sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpf
qadftslsdqeplhvalalqkvkievnesgtpeeiiidrpflfvvrhnptgtvlfmgqvm
ep

SCOPe Domain Coordinates for d1db2b_ are not available.

Timeline for d1db2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1db2a_