PDB entry 1db2

View 1db2 on RCSB PDB site
Description: crystal structure of native plasminogen activator inhibitor-1
Class: hydrolase inhibitor
Keywords: NATIVE SERPIN, hydrolase inhibitor
Deposited on 1999-11-02, released 1999-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.255
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (0-376)
      • engineered (147)
      • engineered (151)
      • engineered (298)
      • engineered (316)
      • engineered (351)
    Domains in SCOPe 2.08: d1db2a_
  • Chain 'B':
    Compound: plasminogen activator inhibitor-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05121 (0-376)
      • engineered (147)
      • engineered (151)
      • engineered (298)
      • engineered (316)
      • engineered (351)
    Domains in SCOPe 2.08: d1db2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1db2A (A:)
    hppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaam
    gfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvk
    qvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpds
    sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
    kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpf
    qadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvv
    rhnptgtvlfmgqvmep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1db2B (B:)
    hppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaam
    gfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvk
    qvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpds
    sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
    kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpf
    qadftslsdqeplhvalalqkvkievnesgtvassstavivsarmapeeiiidrpflfvv
    rhnptgtvlfmgqvmep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1db2B (B:)
    hppsyvahlasdfgvrvfqqvaqaskdrnvvfspygvasvlamlqlttggetqqqiqaam
    gfkiddkgmapalrhlykelmgpwnkdeisttdaifvqrdlklvqgfmphffrlfrstvk
    qvdfseverarfiindwvkthtkgmishllgtgavdqltrlvlvnalyfngqwktpfpds
    sthrrlfhksdgstvsvpmmaqtnkfnytefttpdghyydilelpyhgdtlsmfiaapye
    kevplsaltnilsaqlishwkgnmtrlprllvlpkfsletevdlrkplenlgmtdmfrpf
    qadftslsdqeplhvalalqkvkievnesgtpeeiiidrpflfvvrhnptgtvlfmgqvm
    ep