Lineage for d1qayb2 (1qay B:504-610,B:721-877)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139893Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
  4. 139894Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 139895Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 139896Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 139934Species Pseudomonas mevalonii [TaxId:32044] [56546] (2 PDB entries)
  8. 139938Domain d1qayb2: 1qay B:504-610,B:721-877 [42600]
    Other proteins in same PDB: d1qaya1, d1qayb1

Details for d1qayb2

PDB Entry: 1qay (more details), 2.8 Å

PDB Description: ternary complex of pseudomonas mevalonii hmg-coa reductase with mevalonate and nad+

SCOP Domain Sequences for d1qayb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qayb2 d.179.1.1 (B:504-610,B:721-877) Substrate-binding domain of HMG-CoA reductase {Pseudomonas mevalonii}
dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssapXrlaraqvritpq
qletaefsgeaviegildayafaavdpyraathnkgimngidplivatgndwraveagah
ayacrsghygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqa
laeiavavglaqnlgamralategi

SCOP Domain Coordinates for d1qayb2:

Click to download the PDB-style file with coordinates for d1qayb2.
(The format of our PDB-style files is described here.)

Timeline for d1qayb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qayb1