Lineage for d1dq9c4 (1dq9 C:460-586,C:704-866)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684320Fold d.179: Substrate-binding domain of HMG-CoA reductase [56541] (1 superfamily)
    unusual fold
  4. 1684321Superfamily d.179.1: Substrate-binding domain of HMG-CoA reductase [56542] (1 family) (S)
  5. 1684322Family d.179.1.1: Substrate-binding domain of HMG-CoA reductase [56543] (1 protein)
  6. 1684323Protein Substrate-binding domain of HMG-CoA reductase [56544] (2 species)
  7. 1684324Species Human (Homo sapiens) [TaxId:9606] [56545] (9 PDB entries)
  8. 1684359Domain d1dq9c4: 1dq9 C:460-586,C:704-866 [42595]
    Other proteins in same PDB: d1dq9a1, d1dq9b1, d1dq9c1, d1dq9d1
    complexed with hmg

Details for d1dq9c4

PDB Entry: 1dq9 (more details), 2.8 Å

PDB Description: complex of catalytic portion of human hmg-coa reductase with hmg-coa
PDB Compounds: (C:) protein (hmg-coa reductase)

SCOPe Domain Sequences for d1dq9c4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dq9c4 d.179.1.1 (C:460-586,C:704-866) Substrate-binding domain of HMG-CoA reductase {Human (Homo sapiens) [TaxId: 9606]}
kflsdaeiiqlvnakhipaykletliethergvsirrqllskklsepsslqylpyrdyny
slvmgaccenvigympipvgvagplcldekefqvpmattegclvastnrgcraiglggga
ssrvladXksvvceavipakvvrevlkttteamievninknlvgsamagsiggynahaan
ivtaiyiacgqdaaqnvgssncitlmeasgptnedlyisctmpsieigtvgggtnllpqq
aclqmlgvqgackdnpgenarqlarivcgtvmagelslmaalaaghlvksh

SCOPe Domain Coordinates for d1dq9c4:

Click to download the PDB-style file with coordinates for d1dq9c4.
(The format of our PDB-style files is described here.)

Timeline for d1dq9c4: