Lineage for d1fzec1 (1fze C:142-394)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3002834Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 3002835Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 3002836Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
    automatically mapped to Pfam PF00147
  6. 3002837Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 3002882Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 3002911Domain d1fzec1: 1fze C:142-394 [42477]
    Other proteins in same PDB: d1fzea_, d1fzeb2, d1fzec2, d1fzed_, d1fzee2, d1fzef2
    complexed with ca, nag

Details for d1fzec1

PDB Entry: 1fze (more details), 3 Å

PDB Description: crystal structure of fragment double-d from human fibrin
PDB Compounds: (C:) fibrinogen

SCOPe Domain Sequences for d1fzec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzec1 d.171.1.1 (C:142-394) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
tvqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgs
vdfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstad
yamfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndk
fegncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkk
ttmkiipfnrlti

SCOPe Domain Coordinates for d1fzec1:

Click to download the PDB-style file with coordinates for d1fzec1.
(The format of our PDB-style files is described here.)

Timeline for d1fzec1: