SCOPe 2.08: Domain d1fzee1: 1fze E:200-458

Lineage for d1fzee1 (1fze E:200-458)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
   automatically mapped to Pfam PF00147

6. Protein Fibrinogen C-terminal domains [56498] (7 species)

7. Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
   Uniprot P02675

8. Domain d1fzee1: 1fze E:200-458 [42478]
   Other proteins in same PDB: d1fzea_, d1fzeb2, d1fzec2, d1fzed_, d1fzee2, d1fzef2
   complexed with ca, nag

Details for d1fzee1

PDB Entry: 1fze, 3 Å

PDB Description: crystal structure of fragment double-d from human fibrin

PDB Compounds: (E:) fibrinogen

SCOPe Domain Sequences for d1fzee1:

Sequence; same for both SEQRES and ATOM records:

>d1fzee1 d.171.1.1 (E:200-458) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpff

Timeline for d1fzee1:

• d1fzee1 first appeared (with stable ids) in SCOP 1.55
  
• d1fzee1 appears in SCOPe 2.07