SCOPe 2.06: Domain d1fzge1: 1fzg E:200-459

Lineage for d1fzge1 (1fzg E:200-459)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
unusual fold
Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)
Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
automatically mapped to Pfam PF00147
Protein Fibrinogen C-terminal domains [56498] (7 species)
Species Human (Homo sapiens), beta [TaxId:9606] [68903] (14 PDB entries)
Uniprot P02675
Domain d1fzge1: 1fzg E:200-459 [42470]
Other proteins in same PDB: d1fzga_, d1fzgb2, d1fzgc2, d1fzgd_, d1fzge2, d1fzgf2
complexed with ca

Details for d1fzge1

PDB Entry: 1fzg (more details), 2.5 Å

PDB Description: crystal structure of fragment d from human fibrinogen with the peptide ligand gly-his-arg-pro-amide

PDB Compounds: (E:) fibrinogen

SCOPe Domain Sequences for d1fzge1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fzge1 d.171.1.1 (E:200-459) Fibrinogen C-terminal domains {Human (Homo sapiens), beta [TaxId: 9606]}
scnipvvsgkeceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgs
vdfgrkwdpykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkg
dkvkahyggftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstyd
rdndgwltsdprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmn
wkgswysmrkmsmkirpffp

SCOPe Domain Coordinates for d1fzge1:

Click to download the PDB-style file with coordinates for d1fzge1.
(The format of our PDB-style files is described here.)

Timeline for d1fzge1: