Lineage for d2fiba_ (2fib A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878620Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 878621Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 878622Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 878623Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 878668Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 878672Domain d2fiba_: 2fib A: [42457]
    complexed with ca

Details for d2fiba_

PDB Entry: 2fib (more details), 2.01 Å

PDB Description: recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) complexed to the peptide gly-pro-arg-pro at ph 6.0
PDB Compounds: (A:) fibrinogen

SCOP Domain Sequences for d2fiba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fiba_ d.171.1.1 (A:) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
vqihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsv
dfkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstady
amfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkf
egncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkt
tmkiipfnrl

SCOP Domain Coordinates for d2fiba_:

Click to download the PDB-style file with coordinates for d2fiba_.
(The format of our PDB-style files is described here.)

Timeline for d2fiba_: