Lineage for d3fiba_ (3fib A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878620Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 878621Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 878622Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 878623Protein Fibrinogen C-terminal domains [56498] (7 species)
  7. 878668Species Human (Homo sapiens), gamma [TaxId:9606] [68904] (21 PDB entries)
    Uniprot P02679
  8. 878671Domain d3fiba_: 3fib A: [42455]
    complexed with ca

Details for d3fiba_

PDB Entry: 3fib (more details), 2.1 Å

PDB Description: recombinant human gamma-fibrinogen carboxyl terminal fragment (residues 143-411) bound to calcium at ph 6.0: a further refinement of pdb entry 1fib, and differs from 1fib by the modelling of a cis peptide bond between residues k338 and c339
PDB Compounds: (A:) fibrinogen gamma chain residues

SCOP Domain Sequences for d3fiba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fiba_ d.171.1.1 (A:) Fibrinogen C-terminal domains {Human (Homo sapiens), gamma [TaxId: 9606]}
qihditgkdcqdiankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvd
fkknwiqykegfghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadya
mfkvgpeadkyrltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfe
gncaeqdgsgwwmnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkktt
mkiipfnrl

SCOP Domain Coordinates for d3fiba_:

Click to download the PDB-style file with coordinates for d3fiba_.
(The format of our PDB-style files is described here.)

Timeline for d3fiba_: