Lineage for d1prtb2 (1prt B:4-89)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139425Fold d.169: C-type lectin-like [56435] (1 superfamily)
  4. 139426Superfamily d.169.1: C-type lectin-like [56436] (5 families) (S)
  5. 139605Family d.169.1.2: Aerolysin/Pertussis toxin (APT) domain [56467] (2 proteins)
  6. 139606Protein Pertussis toxin, S2/S3 subunits, N-terminal domain [56468] (1 species)
  7. 139607Species Bordetella pertussis [TaxId:520] [56469] (3 PDB entries)
  8. 139608Domain d1prtb2: 1prt B:4-89 [42425]
    Other proteins in same PDB: d1prta_, d1prtb1, d1prtc1, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth1, d1prti1, d1prtj_, d1prtk_, d1prtl_

Details for d1prtb2

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin

SCOP Domain Sequences for d1prtb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prtb2 d.169.1.2 (B:4-89) Pertussis toxin, S2/S3 subunits, N-terminal domain {Bordetella pertussis}
givippqeqitqhgspygrcanktraltvaelrgsgdlqeylrhvtrgwsifalydgtyl
ggeyggvikdgtpggafdlkttfcim

SCOP Domain Coordinates for d1prtb2:

Click to download the PDB-style file with coordinates for d1prtb2.
(The format of our PDB-style files is described here.)

Timeline for d1prtb2: