SCOPe 2.01: Domain d1tlga_: 1tlg A:

Lineage for d1tlga_ (1tlg A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Lectin TC14 [56463] (1 species)

7. Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [56464] (2 PDB entries)

8. Domain d1tlga_: 1tlg A: [42421]
   complexed with ca, gal, zn

Details for d1tlga_

PDB Entry: 1tlg, 2.2 Å

PDB Description: structure of a tunicate c-type lectin complexed with d-galactose

PDB Compounds: (A:) polyandrocarpa lectin

SCOPe Domain Sequences for d1tlga_:

Sequence; same for both SEQRES and ATOM records:

>d1tlga_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
eld

Timeline for d1tlga_:

• d1tlga_ first appeared (with stable ids) in SCOP 1.55
  
• d1tlga_ appears in SCOP 1.75
  
• d1tlga_ appears in SCOPe 2.02
  
• d1tlga_ appears in the current release, SCOPe 2.08