Lineage for d1byfa_ (1byf A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048153Protein Lectin TC14 [56463] (1 species)
  7. 1048154Species Tunicate (Polyandrocarpa misakiensis) [TaxId:7723] [56464] (2 PDB entries)
  8. 1048155Domain d1byfa_: 1byf A: [42419]
    CASP3
    complexed with act, ca, gol, zn

Details for d1byfa_

PDB Entry: 1byf (more details), 2 Å

PDB Description: structure of tc14; a c-type lectin from the tunicate polyandrocarpa misakiensis
PDB Compounds: (A:) protein (polyandrocarpa lectin)

SCOPe Domain Sequences for d1byfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byfa_ d.169.1.1 (A:) Lectin TC14 {Tunicate (Polyandrocarpa misakiensis) [TaxId: 7723]}
dyeilfsdetmnyadagtycqsrgmalvssamrdstmvkailaftevkghdywvgadnlq
dgaynflwndgvslptdsdlwspnepsnpqswqlcvqiwskynllddvgcggarrvicek
eld

SCOPe Domain Coordinates for d1byfa_:

Click to download the PDB-style file with coordinates for d1byfa_.
(The format of our PDB-style files is described here.)

Timeline for d1byfa_: