SCOPe 2.05: Domain d1bcj21: 1bcj 2:105-226

Lineage for d1bcj21 (1bcj 2:105-226)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1bcj21: 1bcj 2:105-226 [42412]
   Other proteins in same PDB: d1bcj12, d1bcj22, d1bcj32
   complexed with ca, cl, nga; mutant

Details for d1bcj21

PDB Entry: 1bcj, 2.1 Å

PDB Description: mannose-binding protein-a mutant (qpdwghv) complexed with n-acetyl-d- galactosamine

PDB Compounds: (2:) mannose-binding protein-a

SCOPe Domain Sequences for d1bcj21:

Sequence; same for both SEQRES and ATOM records:

>d1bcj21 d.169.1.1 (2:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktvaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwndiscqashtavcef
pa

Timeline for d1bcj21:

• d1bcj21 first appeared (with stable ids) in SCOP 1.55
  
• d1bcj21 appears in SCOPe 2.04
  
• d1bcj21 appears in SCOPe 2.06
  
• d1bcj21 appears in the current release, SCOPe 2.08