| Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (24 proteins) Pfam 00059 |
| Protein Mannose-binding protein A, lectin domain [56458] (2 species) |
| Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1afd31: 1afd 3:105-226 [42410] Other proteins in same PDB: d1afd12, d1afd22, d1afd32 |
PDB Entry: 1afd (more details), 2 Å
SCOP Domain Sequences for d1afd31:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afd31 d.169.1.1 (3:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvtivdnglwndiscqashtavcef
pa
Timeline for d1afd31:
View in 3DDomains from other chains: (mouse over for more information) d1afd11, d1afd12, d1afd21, d1afd22 |