SCOP 1.67: Domain d1afd31: 1afd 3:105-226

Lineage for d1afd31 (1afd 3:105-226)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (22 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1afd31: 1afd 3:105-226 [42410]
   Other proteins in same PDB: d1afd12, d1afd22, d1afd32
   complexed with ca, cl; mutant

Details for d1afd31

PDB Entry: 1afd, 2 Å

PDB Description: structural basis of galactose recognition in c-type animal lectins

SCOP Domain Sequences for d1afd31:

Sequence; same for both SEQRES and ATOM records:

>d1afd31 d.169.1.1 (3:105-226) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvtivdnglwndiscqashtavcef
pa

Timeline for d1afd31:

• d1afd31 first appeared (with stable ids) in SCOP 1.55
  
• d1afd31 appears in SCOP 1.65
  
• d1afd31 appears in SCOP 1.69
  
• d1afd31 appears in the current release, SCOPe 2.08