SCOPe 2.04: Domain d1kmb31: 1kmb 3:105-221

Lineage for d1kmb31 (1kmb 3:105-221)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kmb31: 1kmb 3:105-221 [42407]
   Other proteins in same PDB: d1kmb12, d1kmb22, d1kmb32
   complexed with ca, cl; mutant

Details for d1kmb31

PDB Entry: 1kmb, 2.1 Å

PDB Description: selectin-like mutant of mannose-binding protein a

PDB Compounds: (3:) mannose-binding protein-a

SCOPe Domain Sequences for d1kmb31:

Sequence; same for both SEQRES and ATOM records:

>d1kmb31 d.169.1.1 (3:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

Timeline for d1kmb31:

• d1kmb31 first appeared (with stable ids) in SCOP 1.55
  
• d1kmb31 appears in SCOPe 2.03
  
• d1kmb31 appears in SCOPe 2.05
  
• d1kmb31 appears in the current release, SCOPe 2.08