Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
Domain d1kmb11: 1kmb 1:105-221 [42405] Other proteins in same PDB: d1kmb12, d1kmb22, d1kmb32 complexed with ca, cl; mutant |
PDB Entry: 1kmb (more details), 2.1 Å
SCOPe Domain Sequences for d1kmb11:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kmb11 d.169.1.1 (1:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa
Timeline for d1kmb11:
View in 3D Domains from other chains: (mouse over for more information) d1kmb21, d1kmb22, d1kmb31, d1kmb32 |