SCOPe 2.07: Domain d1afa21: 1afa 2:105-226

Lineage for d1afa21 (1afa 2:105-226)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1afa21: 1afa 2:105-226 [42403]
   Other proteins in same PDB: d1afa12, d1afa22, d1afa32
   complexed with ca, cl, mbg

Details for d1afa21

PDB Entry: 1afa, 2 Å

PDB Description: structural basis of galactose recognition in c-type animal lectins

PDB Compounds: (2:) mannose-binding protein-a

SCOPe Domain Sequences for d1afa21:

Sequence; same for both SEQRES and ATOM records:

>d1afa21 d.169.1.1 (2:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvtivdnglwndiscqashtavcef
pa

Timeline for d1afa21:

• d1afa21 first appeared (with stable ids) in SCOP 1.55
  
• d1afa21 appears in SCOPe 2.06
  
• d1afa21 appears in the current release, SCOPe 2.08