Lineage for d1bch31 (1bch 3:105-226)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940727Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1940730Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1940811Domain d1bch31: 1bch 3:105-226 [42401]
    Other proteins in same PDB: d1bch12, d1bch22, d1bch32
    complexed with a2g, ca, cl, na, nga; mutant

Details for d1bch31

PDB Entry: 1bch (more details), 2 Å

PDB Description: mannose-binding protein-a mutant (qpdwgh) complexed with n-acetyl-d- galactosamine
PDB Compounds: (3:) mannose-binding protein-a

SCOPe Domain Sequences for d1bch31:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bch31 d.169.1.1 (3:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwndiscqashtavcef
pa

SCOPe Domain Coordinates for d1bch31:

Click to download the PDB-style file with coordinates for d1bch31.
(The format of our PDB-style files is described here.)

Timeline for d1bch31: