SCOPe 2.06: Domain d1fihb1: 1fih B:105-226

Lineage for d1fihb1 (1fih B:105-226)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1fihb1: 1fih B:105-226 [42397]
   Other proteins in same PDB: d1fiha2, d1fihb2, d1fihc2
   complexed with ca, cl, nga; mutant

Details for d1fihb1

PDB Entry: 1fih, 1.95 Å

PDB Description: n-acetylgalactosamine binding mutant of mannose-binding protein a (qpdwg-hdrpy), complex with n-acetylgalactosamine

PDB Compounds: (B:) mannose-binding protein a

SCOPe Domain Sequences for d1fihb1:

Sequence; same for both SEQRES and ATOM records:

>d1fihb1 d.169.1.1 (B:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef
pa

Timeline for d1fihb1:

• d1fihb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fihb1 appears in SCOPe 2.05
  
• d1fihb1 appears in SCOPe 2.07
  
• d1fihb1 appears in the current release, SCOPe 2.08