Lineage for d1fiha1 (1fih A:105-226)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048065Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1048173Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1048176Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1048252Domain d1fiha1: 1fih A:105-226 [42396]
    Other proteins in same PDB: d1fiha2, d1fihb2, d1fihc2
    complexed with ca, cl, nga; mutant

Details for d1fiha1

PDB Entry: 1fih (more details), 1.95 Å

PDB Description: n-acetylgalactosamine binding mutant of mannose-binding protein a (qpdwg-hdrpy), complex with n-acetylgalactosamine
PDB Compounds: (A:) mannose-binding protein a

SCOPe Domain Sequences for d1fiha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fiha1 d.169.1.1 (A:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvhivdnglwnddscqrpytavcef
pa

SCOPe Domain Coordinates for d1fiha1:

Click to download the PDB-style file with coordinates for d1fiha1.
(The format of our PDB-style files is described here.)

Timeline for d1fiha1: