SCOPe 2.02: Domain d4kmb21: 4kmb 2:105-221

Lineage for d4kmb21 (4kmb 2:105-221)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d4kmb21: 4kmb 2:105-221 [42394]
   Other proteins in same PDB: d4kmb12, d4kmb22, d4kmb32
   complexed with ca, cl, fuc, zn; mutant

Details for d4kmb21

PDB Entry: 4kmb, 2 Å

PDB Description: complex of 4'-sulfo-lewis-x with a selectin-like mutant of mannose- binding protein a

PDB Compounds: (2:) mannose-binding protein-a

SCOPe Domain Sequences for d4kmb21:

Sequence; same for both SEQRES and ATOM records:

>d4kmb21 d.169.1.1 (2:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa

Timeline for d4kmb21:

• d4kmb21 first appeared (with stable ids) in SCOP 1.55
  
• d4kmb21 appears in SCOPe 2.01
  
• d4kmb21 appears in SCOPe 2.03
  
• d4kmb21 appears in the current release, SCOPe 2.08