| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d4kmb11: 4kmb 1:105-221 [42393] Other proteins in same PDB: d4kmb12, d4kmb22, d4kmb32 complexed with ca, cl, fuc, zn; mutant |
PDB Entry: 4kmb (more details), 2 Å
SCOPe Domain Sequences for d4kmb11:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kmb11 d.169.1.1 (1:105-221) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqkkktavcefpa
Timeline for d4kmb11:
View in 3DDomains from other chains: (mouse over for more information) d4kmb21, d4kmb22, d4kmb31, d4kmb32 |