| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
| Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
| Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
| Domain d1afb21: 1afb 2:105-226 [42385] Other proteins in same PDB: d1afb12, d1afb22, d1afb32 complexed with ca, cl, nga |
PDB Entry: 1afb (more details), 1.9 Å
SCOPe Domain Sequences for d1afb21:
Sequence; same for both SEQRES and ATOM records: (download)
>d1afb21 d.169.1.1 (2:105-226) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kksgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevt
egqfmyvtggrltysnwkkdqpddwyghglgggedcvtivdnglwndiscqashtavcef
pa
Timeline for d1afb21:
View in 3DDomains from other chains: (mouse over for more information) d1afb11, d1afb12, d1afb31, d1afb32 |