SCOP 1.65: Domain d1bv4c_: 1bv4 C:

Lineage for d1bv4c_ (1bv4 C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (6 families)

5. Family d.169.1.1: C-type lectin domain [56437] (21 proteins)

6. Protein Mannose-binding protein A, lectin domain [56458] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1bv4c_: 1bv4 C: [42382]

Details for d1bv4c_

PDB Entry: 1bv4, 1.85 Å

PDB Description: apo-mannose-binding protein-c

SCOP Domain Sequences for d1bv4c_:

Sequence, based on SEQRES records:

>d1bv4c_ d.169.1.1 (C:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

Sequence, based on observed residues (ATOM records):

>d1bv4c_ d.169.1.1 (C:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgiedltgcvvll
tngkwndvpcsdsflvvcefs

Timeline for d1bv4c_:

• d1bv4c_ first appeared (with stable ids) in SCOP 1.55
  
• d1bv4c_ appears in SCOP 1.63
  
• d1bv4c_ appears in SCOP 1.67
  
• d1bv4c_ appears in the current release, SCOPe 2.08