Lineage for d1bv4b_ (1bv4 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1940569Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1940570Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1940571Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1940727Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 1940730Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 1940772Domain d1bv4b_: 1bv4 B: [42381]

Details for d1bv4b_

PDB Entry: 1bv4 (more details), 1.85 Å

PDB Description: apo-mannose-binding protein-c
PDB Compounds: (B:) protein (mannose-binding protein-c)

SCOPe Domain Sequences for d1bv4b_:

Sequence, based on SEQRES records: (download)

>d1bv4b_ d.169.1.1 (B:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd

Sequence, based on observed residues (ATOM records): (download)

>d1bv4b_ d.169.1.1 (B:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtvfedl
tgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefsd

SCOPe Domain Coordinates for d1bv4b_:

Click to download the PDB-style file with coordinates for d1bv4b_.
(The format of our PDB-style files is described here.)

Timeline for d1bv4b_: