Lineage for d1rdj1_ (1rdj 1:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 614335Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 614336Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 614337Family d.169.1.1: C-type lectin domain [56437] (26 proteins)
    Pfam 00059
  6. 614429Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)
  7. 614432Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 614443Domain d1rdj1_: 1rdj 1: [42369]

Details for d1rdj1_

PDB Entry: 1rdj (more details), 1.8 Å

PDB Description: mannose-binding protein, subtilisin digest fragment complex with beta- methyl-l-fucopyranoside

SCOP Domain Sequences for d1rdj1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rdj1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus)}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1rdj1_:

Click to download the PDB-style file with coordinates for d1rdj1_.
(The format of our PDB-style files is described here.)

Timeline for d1rdj1_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1rdj2_